(data stored in ACNUC7421 zone)

EMBL: BA000030.PE40

BA000030.PE40        Location/Qualifiers
FT   CDS_pept        complement(49694..50434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_40"
FT                   /old_locus_tag="SAV_40"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_40"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67749"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RV3"
FT                   /protein_id="BAC67749.1"
FT                   /translation="MYPNARGAAFGTPRRPPPHDGPGAKTPGPLLSDPAAGPSCPRLGG
FT                   GRGGHKCAFGTRAGTGQEQPHTDQKRKTHMNRKSSAHRRPGRRAAVAAGLVLAVGLGVS
FT                   TQVSAQAAVHAPAKASTAQSVSGTPGQAVTRVADFYGAYIDAKGDYTDPDATLATALRN
FT                   HYLTPDFAKRLAAWEKTNAADGVLRAQNIPAQWTATDNGTVGNGHEVIVTLTFGSGETT
FT                   QKTKLFVLVERYNHIVDIDTTSTR"
     gtgtacccga atgcccgagg tgcggcgttc ggcaccccgc ggcgcccgcc gccacacgac        60
     ggccccgggg cgaaaacacc gggcccactc ctgtccgatc cggcagccgg gccgtcctgt       120
     cctcgactcg gaggcggacg aggtggccac aagtgcgcct tcggcacgag agccggaacc       180
     ggccaagagc aaccgcatac agaccagaaa aggaagacac acatgaacag gaagtcctcc       240
     gcacaccgtc gtccgggccg ccgcgcggcc gtcgccgccg gcctcgtcct ggctgtcgga       300
     ctcggtgtgt cgacacaggt gtcggcacag gcggccgtcc atgcccccgc aaaggcgtcc       360
     accgcacagt cggtcagcgg cacgcccggc caagcggtga cccgggtcgc cgacttctac       420
     ggcgcgtaca tcgacgcgaa gggcgactac acggacccgg acgccacgct cgccacggcc       480
     ctccgcaacc actacctgac gcccgacttc gccaagcggc tggcagcctg ggagaagacg       540
     aacgcggcgg acggcgtcct gcgcgcccaa aacatcccgg cgcagtggac ggcgaccgac       600
     aacggcaccg tgggcaacgg ccatgaggtc atcgtcaccc tgaccttcgg cagcggggag       660
     acgacgcaga agaccaagct tttcgtgctg gtggagcggt acaaccacat cgtcgacatc       720
     gacaccacga gcactcgtta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page