(data stored in ACNUC7421 zone)

EMBL: BA000030.PE401

BA000030.PE401       Location/Qualifiers
FT   CDS_pept        472897..474789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_398"
FT                   /old_locus_tag="SAV_398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_398"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68107"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="InterPro:IPR028915"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QU7"
FT                   /protein_id="BAC68107.1"
FT                   /translation="MIRALIDRGRTGHDAAAVLHSRGHPLDAGIRQTMEMAFGHDFSQV
FT                   RVHSDPQAHALTRRMNARALTLGDHIALGQDWYSPDSADELRALAHELAHVVQQRSGCA
FT                   EPPAPSPHTETEHEAVAAADTVMGGGAARVRGRTGIGVARQAVESDPSDLSDTQLEQEW
FT                   LLAAAWLVDHSMLESDYFTVAKYVKSLEDAMRGRAGGAHRAQSEGTLPLEPLRPSILQV
FT                   PLRSPVGAAGSSGAVPAAPRPVVATPLDIPAEGVDMPWVGRGKGISSSELGYLRDSKYF
FT                   WPRFQQSYGSAISLANAQLIASGQAPRVDATWIEHFPGHAAYVNDTLEHHHVGQGSRAV
FT                   PLPSRLHDAYTVFHPQRRVVSTPQGGLRPIPPPRSHADAQTNLNSHVEAGRISGPGIDP
FT                   TKPPTVPAVPPASEVAGQRATPPAAVPRMFGGGRIRGLVGGTILGGLQLLAGYLSAKLQ
FT                   DHFDQQRWERERETIQAQVERELDGMSLEITDRYLDAPGREVFAVVAITSTALRTVQVY
FT                   ATGIQSEVVDQTVYLGSKLASVELGSAARSERHEEVRQIAAPLNLGFPTTTYTTTTLYS
FT                   FAVPSPDLIALRWRALERLRDLDLQAPASQTAQAAAAVQEERTRLSAWLRPSAD"
     atgattcgcg cgctgatcga cagaggccgg acgggccatg atgcggctgc tgttctccac        60
     agccgaggcc acccccttga tgccgggatc aggcagacca tggagatggc cttcggtcat       120
     gacttcagcc aggtgcgtgt gcactccgat ccgcaggctc acgccctgac ccggcggatg       180
     aacgccaggg ctctcaccct gggcgaccac atcgcgctgg gccaggactg gtacagcccc       240
     gattcagcgg acgagctccg ggctctggcg cacgaactcg cgcacgtcgt tcagcaacga       300
     tccggctgtg cggaaccgcc agccccttct ccccatacgg aaaccgagca tgaggctgtc       360
     gcggccgccg acaccgtgat gggcggcgga gccgcccggg tacgcgggcg caccgggatc       420
     ggtgtcgccc ggcaggccgt cgagtccgac ccttccgacc tgtccgacac gcaactcgaa       480
     caggagtggc tcctggccgc ggcatggctg gtcgaccact ccatgctcga gagtgactac       540
     ttcacggtgg cgaagtatgt gaaatccctc gaggacgcga tgcggggacg cgcgggaggc       600
     gcacaccggg ctcagtccga ggggacgctg ccgttggagc cgctgcggcc cagcatcctt       660
     caggtccctc tccggtcgcc cgtcggtgcg gcaggctcca gcggagccgt tcccgccgcc       720
     ccgcgaccgg tagtcgccac gcccctcgac ataccggctg agggggtcga catgccctgg       780
     gtcggccgcg ggaaaggcat ctcgtccagc gagctcggtt acctgcgaga ctcgaagtac       840
     ttctggcccc ggttccagca gagctacggt tccgccatca gcctggccaa cgcacagctc       900
     atcgcgtcgg gccaggctcc ccgcgtcgat gccacctgga tcgagcattt cccgggccat       960
     gccgcctatg tgaacgacac tctggaacac catcacgtcg gccaggggtc tcgtgccgtt      1020
     ccgctgccga gccgtctgca cgacgcctac acggtgtttc acccgcagcg ccgtgtggtg      1080
     agcacaccgc agggaggcct gcgaccgata cccccaccac gctctcacgc cgacgcccag      1140
     accaatctga acagccatgt ggaggccggt cgtatcagcg gcccggggat cgacccgacg      1200
     aagccgccca ctgttccggc cgtcccaccg gcctcagaag tagccggaca acgagccaca      1260
     ccgccggcgg ccgtcccccg gatgttcgga gggggccgga tacgggggct cgtcggcgga      1320
     acgatactgg gcggcctcca gctgctcgcc ggatatctgt ccgccaagct ccaagaccac      1380
     ttcgaccagc agcgctggga acgggaacgg gagaccattc aggcacaggt cgaacgagag      1440
     ctcgacggga tgtccttgga gatcaccgac cgctacctgg acgctcctgg cagggaggta      1500
     ttcgccgtcg tcgcgatcac ctccacggca ctccgcacgg tgcaggtcta cgctacgggc      1560
     atacaaagtg aagtcgtgga ccagaccgtg tacttgggca gcaagctcgc gtctgtggaa      1620
     ctcggctccg cggcccggag tgagcggcat gaagaggtac ggcagatagc ggccccgctc      1680
     aatctgggtt tcccgaccac gacgtacacc accacgacct tgtactcatt cgcagtgccg      1740
     agcccggacc tcatcgcctt gcgttggcgg gccttggaac gacttcgcga cctcgatctg      1800
     caggcacccg cgtcacagac tgctcaggcc gctgccgcgg tccaggagga acgaacccgc      1860
     ctgtccgcct ggctgcgccc ctccgccgac tag                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page