(data stored in ACNUC7421 zone)

EMBL: BA000030.PE405

BA000030.PE405       Location/Qualifiers
FT   CDS_pept        complement(479076..479630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_402"
FT                   /old_locus_tag="SAV_402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_402"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68111"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QU3"
FT                   /protein_id="BAC68111.1"
FT                   /translation="MRSWMLTQIEALAHRTAVPPVAGDDPAAKAEVVRLLDVLGYDAVD
FT                   IGALANAWHCEPGTLVYVWPYLGERSQRITKEEARLWFREIPGEPTPADWVKELIDQAV
FT                   RGPVGGSFAALPFRTRWCPRRSPTSPPRWRRGLCPQVRRPRQRSRLKKAPSPTPPRPRR
FT                   RLPRPVRRAPPGRRRRRGAQA"
     atgcggtcgt ggatgctgac gcagatcgag gcgttggcgc accggaccgc agtgcccccc        60
     gtggccggtg atgacccggc cgccaaggcc gaggtcgtcc ggcttctcga cgtcctgggc       120
     tacgacgccg tcgacatcgg cgcactcgcc aacgcctggc actgcgagcc gggcacactc       180
     gtctatgtct ggccctacct cggagagcgc tcccagagaa tcaccaagga ggaggcacgg       240
     ctctggttcc gggaaatccc gggcgagcca acgcccgccg actgggtcaa ggaactcatc       300
     gaccaggccg tccgaggccc cgtgggcggc tctttcgccg ccctaccgtt caggacacgg       360
     tggtgcccga ggcgttcacc gacgtcgccg ccccggtgga ggcgcggact gtgtccacag       420
     gtccggcgtc cgaggcagcg gtcacgactg aaaaaggcac ccagtcccac cccgccaaga       480
     ccgcggcgcc gactgccgcg tcccgtccgg cgcgcaccgc caggccgtcg gcggcgtcgc       540
     ggcgcccagg cgtga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page