(data stored in ACNUC7421 zone)

EMBL: BA000030.PE409

BA000030.PE409       Location/Qualifiers
FT   CDS_pept        484941..485378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_406"
FT                   /old_locus_tag="SAV_406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_406"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68115"
FT                   /db_xref="GOA:Q82QT9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QT9"
FT                   /protein_id="BAC68115.1"
FT                   /translation="MCLYVTDEDDRPLQLHSVYSPGHPWHMIGGAMDLGERPWDAVVRE
FT                   GREETGMTAVGPARLLATVFGLPREGRSYSTLQLIFDGGRLTAEQIRGITLNSREHDEA
FT                   RVLPLAEWEALMPARDFVRLRAVEEARRTGVAAYVDTWGHA"
     gtgtgcctct acgtcaccga cgaggacgac cggccgctgc agctgcactc cgtctactcc        60
     cccggccacc cctggcacat gatcggcggc gcgatggatc tgggcgagcg gccctgggac       120
     gcggtggtgc gcgagggccg ggaagagacc ggcatgaccg ccgtgggccc ggcccggctg       180
     ctggccaccg tgttcgggct gccccgggag ggacgttcgt acagcactct gcagctgatc       240
     ttcgacggcg gtcgtctgac cgcggaacag atccggggca tcaccctcaa ttcgcgcgag       300
     cacgacgagg cccgcgtcct gcccttggcc gagtgggagg ccttgatgcc ggcccgcgat       360
     ttcgtgcggc tgcgcgccgt ggaggaggcc cgccgcaccg gcgtggccgc atacgtcgac       420
     acctgggggc acgcatga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page