(data stored in ACNUC7421 zone)

EMBL: BA000030.PE41

BA000030.PE41        Location/Qualifiers
FT   CDS_pept        complement(50521..50901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_41"
FT                   /old_locus_tag="SAV_41"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_41"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67750"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RV2"
FT                   /protein_id="BAC67750.1"
FT                   /translation="MMKSVIRKAAGLAGASVAVAAMSVTGASAAQAESPTHGCPYPYVC
FT                   FYVDEDAYNAGTPITKYRDVTSSYQTVRSRPHYHVVNTRNDDVAYLRLQDGNSICLVPN
FT                   SETVFANAYSVTGIKISSSSTC"
     ttgatgaagt ccgtcatccg aaaggcagca ggcctcgcag gcgcgagcgt ggccgtcgca        60
     gccatgtccg tgaccggcgc atcggcagcc caggcggagt cccccaccca cggctgcccg       120
     tacccctacg tctgcttcta cgtggacgag gacgcctata acgcgggcac accgatcacg       180
     aagtaccgcg atgtcaccag ttcctaccag acggtcagat cccggccgca ctaccacgtc       240
     gtgaacaccc ggaacgacga cgtggcgtac ctacggctcc aggacgggaa ctcgatctgc       300
     ctggtgccga attccgaaac cgtgttcgcg aacgcttaca gcgtcaccgg aataaagatc       360
     tccagcagtt ccacctgctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page