(data stored in ACNUC7421 zone)

EMBL: BA000030.PE437

BA000030.PE437       Location/Qualifiers
FT   CDS_pept        581626..582858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_432"
FT                   /old_locus_tag="SAV_432"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_432"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68142"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR026457"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QS3"
FT                   /protein_id="BAC68142.1"
FT                   /translation="MHRMKVRAIPTAVTAALLVTAAHPAAGAAAPAEAVPTRFTVDTTS
FT                   DAVDADPSDGRCRTASGTCSLRAAVMAANSRPGSTIALPSGRYRLTIPPDPRLITGDHP
FT                   DPTTGDLNVDAPTTITGAGARATVIDANHLDRAFRLRADTRMSDVTITGGEARQRELPF
FT                   TDTGGGGIANERHLTLRRVAVTGNSAGYGGGVFNVPDSHLDLVDSTVSGNAAGEAGGIR
FT                   FDDSGTVTNSTIAGNRVTDPGDRPGSLGGYGGGIDIRGLGTVEILDSTITGNRSSHHGG
FT                   GINIAPAYLDSLPAPIPDIVDLPLGRLVLRNSIVAGNTADCAKAFAIIASRGHNIDGDG
FT                   SCRLTATGDLPRRDPLVGPLADNGGPTDTTALLPGSPALDAADGCPATDQRGVARPQGT
FT                   ACDIGAYEYTP"
     gtgcaccgca tgaaggtcag agccatcccg acagcagtca ccgccgctct ccttgtcact        60
     gcggcgcatc ccgccgccgg tgccgccgcc cccgccgaag ccgtgccgac gaggttcacc       120
     gtcgacacca catccgacgc ggtggacgcc gacccgtcgg acggccggtg ccgcaccgcg       180
     tccggcacgt gcagcctgcg cgccgcggtg atggccgcca actcccggcc gggcagcacg       240
     atcgcgctgc cttccggccg ctaccggctg acgatcccgc ctgacccccg gctgatcacc       300
     ggcgaccatc ccgacccgac cactggcgac ttgaacgtcg acgcgcccac cacgattacc       360
     ggcgccggtg cgcgggctac cgtcatcgac gccaaccacc tggaccgggc cttccgcctg       420
     cgggcggaca cccgtatgtc cgatgtgacg atcacggggg gagaggcaag gcagcgggaa       480
     cttcccttca ccgacaccgg gggcggcggc atcgccaacg aacggcatct gacgctgcgt       540
     cgggtcgcgg tgaccgggaa ttccgccggc tatgggggcg gcgtcttcaa cgtcccggac       600
     tcccacctgg atctcgtcga cagcacggtc agcgggaacg ccgccggaga ggccggaggc       660
     atcaggttcg acgacagcgg cactgtgacg aactcgacga tcgccggcaa ccgcgtgacg       720
     gaccccggcg accgccccgg cagcctcggc ggctacggcg gaggcatcga catccgcgga       780
     ctgggaaccg tggaaatcct cgactcgacc atcacgggga accgttccag ccaccacggg       840
     ggcggaatca acatcgcccc cgcctacctc gacagcctgc ccgcaccgat ccccgacatc       900
     gtcgatctgc ctcttggacg tctggtcctg cgcaactcca tcgtcgcggg caacaccgcc       960
     gactgcgcga aggccttcgc catcatcgcg tctcgaggcc acaacatcga cggcgacggc      1020
     agctgccggc tgaccgccac gggcgatctg ccccgccgtg acccgctggt ggggccgctc      1080
     gcggacaacg gcggccccac agacaccacg gcgctgctgc cgggcagccc cgccctcgac      1140
     gcggccgacg gctgcccagc caccgatcag cgcggcgtcg cccgccccca gggcaccgcc      1200
     tgcgacatcg gcgcctacga gtacacgcca tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page