(data stored in ACNUC7421 zone)

EMBL: BA000030.PE440

BA000030.PE440       Location/Qualifiers
FT   CDS_pept        585449..585874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_435"
FT                   /old_locus_tag="SAV_435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_435"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68145"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QS0"
FT                   /protein_id="BAC68145.1"
FT                   /translation="MPMGAADPALRPRRQGLLRPDACACGDPLPSIKVRGRVADLLSFP
FT                   RRGGGTVRIVPMAFETLLESIPDIDLFQIVQTSPTTLRVRIRSTTGADRERLWTAVRQE
FT                   LAALLGAHGADQVSVERAHEPPEQSPGGKYRVVMPHS"
     gtgccaatgg gcgcagccga tcctgcgcta cgacctcggc gacagggtct gctgcgcccg        60
     gacgcgtgcg cgtgcggaga cccgctcccc tccatcaagg tccgtggccg cgtggccgac       120
     ctgctgtcct tcccgcgccg gggcggcggc accgtccgga tcgtgcccat ggccttcgag       180
     accctcctgg aaagcatccc ggacatcgac ctgttccaga tcgtccagac gtcgcccacc       240
     accctccggg tgaggatccg gtccaccacc ggagccgatc gagaacggct gtggacggcg       300
     gtgcgccagg agctggccgc cctcctcggc gcccacgggg cggaccaggt cagtgtcgaa       360
     cgggcccacg agccacccga gcagtcgccg ggcggcaagt accgtgtcgt catgccccat       420
     tcgtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page