(data stored in ACNUC7421 zone)

EMBL: BA000030.PE447

BA000030.PE447       Location/Qualifiers
FT   CDS_pept        596538..596843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_442"
FT                   /old_locus_tag="SAV_442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_442"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68152"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QR3"
FT                   /protein_id="BAC68152.1"
FT                   /translation="MADVKVGLYVSLQAKPGKEEDVADFLRKGLDLVQEEPGTVAWFAV
FT                   RLNATAFAIFDAFPDVSGRQAHLAGRLAAALMERAPDLLAQPPSIEQLDILAHKLP"
     atggcagacg tcaaagtcgg gctgtacgta tctctccagg ccaagcccgg caaggaggaa        60
     gacgtcgctg actttctccg caagggcctt gacctcgtgc aggaggagcc cggcaccgtc       120
     gcctggttcg ccgtgcgcct gaacgcgacc gccttcgcga tcttcgacgc cttccccgac       180
     gtctccggac gccaggccca cctcgcaggc cggctggccg cggccctgat ggaacgagcc       240
     cccgatctgc tcgcccagcc gccttccatc gagcaactcg acattctcgc ccacaaactg       300
     ccctga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page