(data stored in ACNUC7421 zone)

EMBL: BA000030.PE454

BA000030.PE454       Location/Qualifiers
FT   CDS_pept        603569..603973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_449"
FT                   /old_locus_tag="SAV_449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_449"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68159"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QQ6"
FT                   /protein_id="BAC68159.1"
FT                   /translation="MIYHINRVTMKATATPEQIEGVLESWRNQGRSNPAIKSFVVGRNH
FT                   GGDYTYGAVFVVEHLDGLFAYLTHPTTYQTDHLGLHLVERLEIFDVSDDDDPDLNAKIQ
FT                   ELHRRRNELNPQIAGMLADVPTYTGSGVDD"
     atgatttacc acatcaacag agtcacgatg aaggccactg cgacgcctga gcagatcgaa        60
     ggggtgctgg agagctggcg caatcagggc cggtcgaacc ccgccatcaa gtccttcgtg       120
     gtcggccgca accacggcgg cgactacacg tacggcgcgg tgttcgtcgt cgaacatctc       180
     gacgggctct tcgcctacct gacgcacccg accacctacc agaccgacca cctcgggctg       240
     cacctggtcg aacggctgga gatcttcgac gtcagtgacg acgacgaccc tgacctgaac       300
     gccaagatcc aggaactgca ccggcgccgc aacgagctca acccgcagat cgccggcatg       360
     ctcgcggacg tgcccaccta caccggctcc ggcgtggacg actga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page