(data stored in ACNUC7421 zone)

EMBL: BA000030.PE458

BA000030.PE458       Location/Qualifiers
FT   CDS_pept        606058..606540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_453"
FT                   /old_locus_tag="SAV_453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_453"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68163"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QQ2"
FT                   /protein_id="BAC68163.1"
FT                   /translation="MVTAVRARARAGSAWQACRGARRSSQHSSEGVRRMDEKEFLRTVA
FT                   ERTGLSRQEAADLTWATLETLARRLSPGEARDLITELPEGLAEAVRRGTTDRIERFGHH
FT                   DSVRRVAERTMLKEEEADRGVRTVLAVLREAISEKEFNDLMSQLGTDFSQALESAG"
     gtggtcaccg ccgtccgtgc gcgggcgcgg gccgggtcgg cgtggcaggc ttgcaggggg        60
     gcgcgccgtt cgtcgcaaca cagcagcgaa ggggtacgcc gcatggatga gaaggaattc       120
     ctccgtaccg tcgccgagcg caccggactg agccggcagg aggcggcgga cctgacctgg       180
     gccacactcg agacgctggc ccgccgactg agcccggggg aagccaggga cctgatcacc       240
     gagctccccg agggcctcgc ggaggcggtg cgccggggaa ccacggaccg catcgagcgc       300
     ttcggccacc acgacagcgt gcggcgcgtg gccgaacgca ccatgctcaa ggaggaggaa       360
     gccgaccggg gtgtgcggac cgtactggcc gtgctccggg aggcgatcag cgagaaggag       420
     ttcaacgacc tgatgtcgca gctcggaact gacttctccc aggccctcga atccgccggg       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page