(data stored in ACNUC7421 zone)

EMBL: BA000030.PE459

BA000030.PE459       Location/Qualifiers
FT   CDS_pept        606685..607839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_454"
FT                   /old_locus_tag="SAV_454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_454"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68164"
FT                   /db_xref="GOA:Q82QQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QQ1"
FT                   /protein_id="BAC68164.1"
FT                   /translation="MIMTADVPETSSGRSVRVALVADPGLPSEIARALAPRLPDHLRRA
FT                   VGARVRWQVDTMTAPLSVSEQADVSDIAEAVRSHLDGAEWDVAIFLTDFPRRARLYPIS
FT                   VEVDTALRAALISLPALGVRRLRRRVRQAVVDVVRELVAHEETPRHPEVIGRPPREPVP
FT                   DTRPGPEQPQRYVVPGLRGHTRLVAGMVYANRPWRLFGSLSRALAGVFATATVLFINSA
FT                   TWNLATALGAVQHAVITAGSAVALTLWIIVDHQLWERGTHLPARHHPLYPYNLVTLVTI
FT                   ALAVVVLAAALFATLVAVSFLLLDASVLRKFIGRQVGVGDYLFLAWFITAIAMIGGAFG
FT                   TSLEGDEKVSDAAYGRRQRERQRMLRQMPRPERGERRGPDTTDG"
     gtgatcatga cagctgacgt gcccgagaca tcctccggca gatccgtgcg cgtcgcgctg        60
     gtggccgacc ccggcctgcc gtcggagatc gcccgggctc tcgccccccg gttgcccgac       120
     catctccgcc gggcagtcgg tgctcgggtc agatggcagg tcgacacgat gaccgccccg       180
     ctcagcgtga gcgagcaggc cgacgtctcc gacatcgccg aggccgtcag aagccacctg       240
     gacggtgccg aatgggacgt ggcgatcttt ctcaccgact ttccgcggcg ggcccggctc       300
     tacccgatca gcgtcgaggt cgacaccgcg ctccgggccg cgctcatctc ccttcccgcc       360
     cttggggtcc gccgccttcg gcgccgggtg cggcaggccg tcgtggatgt cgttcgagag       420
     ctggtcgcgc acgaggagac gcccaggcac ccggaggtga tcggccgccc gccgcgcgaa       480
     ccggtaccgg acacccgtcc cggccccgag cagccccagc gctacgtcgt gcccggcctg       540
     cgcggccaca cccgactcgt cgccggcatg gtgtacgcca accgcccctg gcggctgttc       600
     ggctccctct cccgggccct ggcgggcgtg ttcgccacgg ctacggtgct gttcatcaac       660
     agcgccacct ggaacctcgc caccgcactc ggcgccgtgc agcatgccgt catcaccgct       720
     gggtccgccg tcgcgctcac cctgtggatc atcgtcgacc accagctctg ggagcgcggc       780
     acccacctcc ccgcacggca ccatcccctg tacccctaca acctggtcac cctggtcacc       840
     atcgcgctcg cggtggtggt gctggccgcg gcgctgttcg cgactctggt cgccgtctcc       900
     ttcctgctgc tggacgcgtc cgtcctgcgc aagttcatcg gacggcaggt cggcgtcggc       960
     gactacctct tcctggcctg gttcatcacc gccatcgcga tgatcggcgg ggccttcggc      1020
     accagcctcg aaggggacga gaaggtgtcc gacgccgcct atggacgacg gcagcgtgaa      1080
     cgtcagcgga tgctgcggca gatgccgcgg ccggaacgag gcgaacgcag ggggccggac      1140
     accaccgacg ggtga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page