(data stored in ACNUC7421 zone)

EMBL: BA000030.PE467

BA000030.PE467       Location/Qualifiers
FT   CDS_pept        complement(614386..614700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_462"
FT                   /old_locus_tag="SAV_462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_462"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68172"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QP3"
FT                   /protein_id="BAC68172.1"
FT                   /translation="MTTENCRRDLTAICKAADSGYLLQVIRDGSFEPLAQKDLSHWPDW
FT                   PTFPVDAAHAAGCELVMLGYMIWPDTVTPDSLIGWRAVPDQQAWSAKVGTFAQLQAAGI
FT                   "
     atgacaactg agaactgccg ccgtgatctc actgccatct gcaaggccgc ggacagcggc        60
     tatctcctgc aagtgatccg ggatggcagc ttcgagcccc tcgcccagaa ggacctctca       120
     cactggcccg actggccgac attcccggtc gacgccgcac atgcggcggg gtgcgaactc       180
     gtcatgctcg gctacatgat ctggcccgac actgtcaccc ccgactcgct gatcggctgg       240
     cgtgctgtac cggatcagca ggcatggtcg gcgaaggtcg gcaccttcgc ccaactgcag       300
     gccgccggaa tctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page