(data stored in ACNUC7421 zone)

EMBL: BA000030.PE469

BA000030.PE469       Location/Qualifiers
FT   CDS_pept        complement(615205..615528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_464"
FT                   /old_locus_tag="SAV_464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_464"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68174"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QP1"
FT                   /protein_id="BAC68174.1"
FT                   /translation="MLAAAGVLSMPLIWLLDSPDAGQLVGASIQAAVGVAALIGALFQH
FT                   PASRTDDTAARTGVARASGGGTAVTGVECPQGRGSGSAQTERTGNATAGGDGSSAVSSI
FT                   DYT"
     gtgctggcgg cggccggggt tctctccatg ccgttgatct ggctgctgga cagccccgat        60
     gcggggcagc tggtcggggc ctccatccag gccgccgtcg gcgtcgcggc cctgatcggg       120
     gcgctgttcc agcacccggc aagccgcacg gacgacacgg ccgcgcggac cggagtggcg       180
     cgcgcgagcg gcggaggcac ggctgtcacc ggcgttgagt gcccgcaggg ccggggcagc       240
     ggatcggcgc agacggagag gaccggcaac gctaccgccg gtggcgacgg cagcagcgct       300
     gtcagcagca tcgactacac ctga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page