(data stored in ACNUC7421 zone)

EMBL: BA000030.PE477

BA000030.PE477       Location/Qualifiers
FT   CDS_pept        complement(624344..625432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_472"
FT                   /old_locus_tag="SAV_472"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_472"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68182"
FT                   /db_xref="GOA:Q82QN3"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QN3"
FT                   /protein_id="BAC68182.1"
FT                   /translation="MRPSTEPPQASVRLPHPPVHRDRLQPAPFLSSLAAEAGTYSPEVG
FT                   ELLARNVGDLLTTVVTERLGRDAAPTDAGRQTLLQRIRHFINAHLADPALSAEAIAAHH
FT                   HISVRHLQRLFQAEGTTVNGWIRGRRLKECGRELSRPRRSRPAVSAVGLRQPRPLQPGV
FT                   PRRLRHVAARMAGHGRCDRRCGSKTLRAWVSGRVLKSGAPVGRPRLRLGTRLRSGRAGL
FT                   TGRLVGDQQAACQASTSSVLGLRRVGRRAERFESSESGPPTTGRPRRSSATGVRSGRRT
FT                   GSGRTPRRRAVRRSGARRDGAGCGCRRRSGTHGARRPGRGVLVTLLQAAELLRRPLVED
FT                   GAVGRSFTVRAVARPAYTACVA"
     atgcggccct cgacggagcc gccccaggcg tcggtgcggc tacctcatcc accagttcat        60
     cgcgaccggc tccaaccggc gccgttcctg tcgagtctgg ccgccgaagc cgggacgtac       120
     agccccgagg tcggtgaatt gctcgcccgc aatgtgggag acctgctcac gacggtcgtc       180
     accgaacggc tcggccggga tgccgccccg acggacgccg gccggcagac cctgctgcag       240
     cggatccggc acttcatcaa cgcacacctt gcggatccgg ccctgtcggc ggaagcaatc       300
     gccgcccacc accacatctc cgtacgccac ctgcaacgcc tgttccaggc cgaggggacg       360
     acggtcaacg gatggatccg cggccgtcgt ctcaaggagt gcggccgcga gctcagccgc       420
     ccccgccgga gcaggccggc cgtgtccgcg gtggggcttc gtcagccccg cccacttcag       480
     ccgggcgttc cgcgccgcct acggcatgtc gccgcgcgaa tggcaggcca cggccgatgc       540
     gaccggcggt gcggctccaa gactctccgc gcctgggtga gcggccgcgt cctcaagtca       600
     ggcgctcccg tgggccgccc tcgcttgcga ctcggtacgc gattgaggtc aggacgtgcc       660
     ggcctgacgg gtcggctggt aggtgatcag caggcagcat gccaggcgag caccagttcg       720
     gtgctcggct tgcggcgggt cggccgacgg gcggagcggt tcgagagcag tgaaagtggg       780
     ccgcctacga ctggcaggcc aaggcggtca agtgccaccg gggtgagatc cgggcggcgt       840
     acgggttcag ggcgaacacc gaggcgccgt gccgtccgca gaagcggtgc gcgccgagat       900
     ggcgccggtt gcgggtgtcg acggcggtca gggactcacg gggccagacg gccgggtcgc       960
     ggcgtactcg taaccctgct ccaggcggcg gaacttctgc gccgcccgct cgtggaagac      1020
     ggtgccgtcg gcaggagctt caccgtgcgc gcggtcgccc ggccggcgta caccgcgtgc      1080
     gtcgcctga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page