(data stored in ACNUC7421 zone)

EMBL: BA000030.PE480

BA000030.PE480       Location/Qualifiers
FT   CDS_pept        complement(627377..627523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_475"
FT                   /old_locus_tag="SAV_475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_475"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68185"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QN0"
FT                   /protein_id="BAC68185.1"
FT                   /translation="MQPNEIIEVLNRPISQELLARDVTRSHIGMSTTKNAPKLPWPPSR
FT                   TGS"
     atgcagccga acgagatcat cgaggttctg aaccgcccga tcagccagga gctgctggcc        60
     cgtgacgtga cccggtcgca tatcggcatg tctacgacga agaacgcccc caaactcccg       120
     tggccaccct cgcgcacagg ctcctga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page