(data stored in ACNUC7421 zone)

EMBL: BA000030.PE482

BA000030.PE482       Location/Qualifiers
FT   CDS_pept        628625..628882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_477"
FT                   /old_locus_tag="SAV_477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_477"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68187"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QM8"
FT                   /protein_id="BAC68187.1"
FT                   /translation="MWLRLAALAGWPADQTANFEIEFWARRALYDAGEISTHTFWSGML
FT                   YGQLTAPPGSTLLYALRSTDAEMWTHTDEDVVRVSCLTEG"
     atgtggctac ggctggccgc actcgccgga tggcccgccg atcagaccgc caacttcgag        60
     atcgagttct gggcacgccg cgcgctgtac gacgccggcg agatcagcac ccacaccttc       120
     tggagcggca tgctgtacgg ccaactgacc gccccgccgg gcagcaccct gctctacgca       180
     ctgcgcagca ccgacgccga gatgtggacc cacaccgacg aggacgtcgt ccgggtgtcc       240
     tgtctcactg aaggttga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page