(data stored in ACNUC7421 zone)

EMBL: BA000030.PE490

BA000030.PE490       Location/Qualifiers
FT   CDS_pept        632948..633259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_485"
FT                   /old_locus_tag="SAV_485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_485"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68195"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QM0"
FT                   /protein_id="BAC68195.1"
FT                   /translation="MPAGRPSTENPAVPQPPPTPSLPRREPLHDGQTTQLTCLRTRVLA
FT                   TAYSSSDCWTQRTASSPTRPWQRSPAVTLPQPSPRRVPAGPGDAPQHPDPGRGRGSRN"
     atgcctgcgg ggcggccgtc gacagagaat ccggccgtcc cgcagccccc gccgacacca        60
     tcactccctc gaagggagcc ccttcatgac ggacagacca cccaactcac gtgcctgcga       120
     accagggtgc tggccaccgc gtacagcagc agcgactgct ggacccagcg cacggcttcc       180
     tcaccgacca ggccgtggca gcgctcgcca gccgtgaccc tgccgcagcc gagccctcgc       240
     cgcgtccctg ctggtcccgg agacgctcca caacatccag atcctgggcg cggccgtgga       300
     agccggaatt ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page