(data stored in ACNUC7421 zone)

EMBL: BA000030.PE495

BA000030.PE495       Location/Qualifiers
FT   CDS_pept        complement(636261..636563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_490"
FT                   /old_locus_tag="SAV_490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_490"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68200"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QL5"
FT                   /protein_id="BAC68200.1"
FT                   /translation="MTLTSQVHRSVASGVRSFRRVQPSICLIIRNGCSRSNLRRNACQR
FT                   RSMPCPDPVADDHSQTGSGSCPPGRKSASRHFNVPLMRGSSPVWSVHVERVVRRG"
     atgacgttga ccagccaggt ccaccggtcc gtcgcctcgg gagtgcggag cttccggcgg        60
     gtccagccca gcatctgctt gattatccgg aacggttgct ccaggtcgaa tctgcggagg       120
     aacgcctgcc agcgcagatc gatgccctgt cccgaccccg tggccgacga ccacagtcag       180
     actgggagcg gatcgtgccc gccgggcagg aagtcggcct ccaggcattt caacgtgccc       240
     ttgatgaggg ggagttcgcc ggtgtggtcg gtccatgtgg agcgggtggt caggcgagga       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page