(data stored in ACNUC7421 zone)

EMBL: BA000030.PE499

BA000030.PE499       Location/Qualifiers
FT   CDS_pept        complement(640006..640821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_494"
FT                   /old_locus_tag="SAV_494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_494"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68204"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QL1"
FT                   /protein_id="BAC68204.1"
FT                   /translation="MSARFEEIDWRATFMGEISLRRRRDPVSGEDVYEVKLGDEYLMSS
FT                   LFTAGEVELARLGLAELPDGPLDVAVGGLGLGYTARTALDDPRVRSLIVVDALAEVIDW
FT                   HRRGLVPLGAGLASDPRCRLVRGDFFAMAAGSAAAARPVPADGAKVGGPVPAGGTARGA
FT                   SAAPRGLDPETPGRRFHAILLDVDHSPRHVLHPGHAALYRLAGLTAVAELLHPGGVFAL
FT                   WSNDPPDEEFGSVLAEAFTETAAHVVNFDNPLQGGTAANTVYVARRYDG"
     atgagcgcgc gtttcgagga gatcgactgg cgggcgacct tcatgggtga gatcagcctg        60
     cggcgtcggc gggaccccgt gtcgggggag gacgtgtacg aggtgaagct cggcgacgag       120
     tacctgatgt ccagcctctt caccgcgggg gaggtggagc tggcccggct cggcctggcg       180
     gagctgcccg acggcccgct cgatgtcgcc gtgggcggac tcggcctcgg ttacacggcc       240
     cgaacggcgc tggacgatcc gcgggtgcgc tcgctgatcg tcgtcgacgc cctggccgag       300
     gtgatcgact ggcaccggcg cgggctcgta ccgctgggcg cgggactggc gtcggacccc       360
     cggtgccggc tggtgcgcgg ggacttcttc gcgatggctg cggggagcgc ggcggcggcc       420
     agaccggtgc ccgcggacgg cgcgaaggtg ggcggtccgg tgcctgctgg gggcacggcc       480
     cgcggcgcca gtgcggctcc gcgcggtctg gaccccgaga ctcccggccg ccgtttccac       540
     gcgatcctgc tggacgtcga ccactcaccg cgccatgtgc tgcaccccgg ccatgccgcg       600
     ctctaccgcc tggccggtct gaccgctgtg gccgaactac tccatcccgg gggcgtgttc       660
     gcgctgtggt cgaacgaccc gccggatgag gagttcggct cggtgctcgc ggaggccttc       720
     acggagaccg ctgcgcacgt ggtcaatttc gacaatccgc ttcagggcgg gaccgcggcc       780
     aacactgtct acgtcgcccg caggtacgac ggctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page