(data stored in ACNUC7421 zone)

EMBL: BA000030.PE501

BA000030.PE501       Location/Qualifiers
FT   CDS_pept        641343..641822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_496"
FT                   /old_locus_tag="SAV_496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_496"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68206"
FT                   /db_xref="GOA:Q82QK9"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QK9"
FT                   /protein_id="BAC68206.1"
FT                   /translation="MTGDWRMDRIGAALRGENPTVLRRLESGFAVIGDVQFLPGYSVLL
FT                   VDEPGVQRLSDLPKARRLSFLSDMDRLGEAVEHVCQRLDPDFRRVNLEILGNTDPFLHA
FT                   HVWPRFEWEPTELVGKPVWLYPGDRWSDEGFRLGPQHDVLRDGIESELDRLRSMG"
     atgactggtg actggaggat ggatcggatc ggggctgctc tgcgaggtga gaacccgacc        60
     gtgctgcggc ggcttgagtc ggggttcgcg gtgatcggcg acgttcagtt cttgccgggt       120
     tactcggttc tgctcgtgga cgaaccaggt gttcagcggc tgtctgatct gccgaaggcg       180
     aggcggctgt cgtttctgtc cgacatggac cggctcggag aagctgttga gcacgtctgc       240
     caacgcttgg accccgactt ccgccgggtc aacctggaga ttctggggaa caccgacccg       300
     ttcttgcatg cccacgtctg gccgcggttc gagtgggagc cgaccgagct ggtgggcaag       360
     cctgtgtggc tgtatccggg tgaccggtgg agtgacgagg ggttcagact ggggccgcag       420
     catgacgtgc tgcgggacgg gatcgagagc gaactggatc ggttgcgttc gatgggctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page