(data stored in ACNUC7421 zone)

EMBL: BA000030.PE507

BA000030.PE507       Location/Qualifiers
FT   CDS_pept        complement(645222..645671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_502"
FT                   /old_locus_tag="SAV_502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_502"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68212"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QK4"
FT                   /protein_id="BAC68212.1"
FT                   /translation="MSPLHPSDHWLPPRPANRASRSSNTHLEPKVECGPSSVGVHVLEW
FT                   VHTSLVPERSADLHADAKPLKIVFTDDRGDPINPPVYKVTQTDPERVTLEVYTTAHRCK
FT                   WSVIVHWSVNGDDHKTKIPDKGQYVVTGTDAATEHRATDGELLRW"
     gtgagccccc tgcatccgag tgatcactgg ctgccgccca gacccgcgaa cagagccagc        60
     cgcagttcaa acactcactt agaacccaaa gtggagtgcg gccccagcag cgtaggagtg       120
     cacgtcctgg agtgggtgca tacgagcctg gttcccgaga ggtcggcaga tctgcacgct       180
     gatgccaaac ccctgaagat cgtattcacg gacgaccgtg gcgatccgat caaccctccc       240
     gtgtacaagg tgacgcagac cgacccagag cgcgtcaccc tcgaggtcta caccaccgcg       300
     caccgatgca agtggagtgt gattgtgcac tggagcgtca acggcgacga ccacaagacg       360
     aagatccctg ataagggcca gtacgtcgtg acgggcacgg atgcggccac cgaacacagg       420
     gcaactgacg gcgaactgct ccgctggtaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page