(data stored in ACNUC7421 zone)

EMBL: BA000030.PE508

BA000030.PE508       Location/Qualifiers
FT   CDS_pept        complement(646464..646712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_503"
FT                   /old_locus_tag="SAV_503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_503"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68213"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QK3"
FT                   /protein_id="BAC68213.1"
FT                   /translation="MPAGTAGPAPAAGRELLGPGRQQRRDQRPPASEAHLNWSLITLMS
FT                   RRLTRKGHPDGWKKTGPMRKPGPTTLNQPRTSREMDG"
     atgcccgccg gcacagccgg tccggcaccg gccgcgggcc gggagcttct cgggccaggg        60
     cggcagcagc ggcgcgatca gcgcccaccg gccagcgaag ctcacctgaa ctggtcgctc       120
     atcaccctca tgagcaggag gctgacacgc aagggccacc ccgacggctg gaagaagacc       180
     ggcccgatga ggaagcccgg accgaccact ctcaaccagc cgcgcacctc gcgagaaatg       240
     gacggatga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page