(data stored in ACNUC7421 zone)

EMBL: BA000030.PE512

BA000030.PE512       Location/Qualifiers
FT   CDS_pept        650027..650887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_506"
FT                   /old_locus_tag="SAV_506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_506"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68216"
FT                   /db_xref="GOA:Q82QK0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QK0"
FT                   /protein_id="BAC68216.1"
FT                   /translation="METASLRAAPPPRFHPMASSAGPEDRDTEARSRPATRPLLLRIVT
FT                   VVGSSASFYLLLSVVPAYAQSAPGGGSDKAGLVTGALMLATVAGELTAPWLAARCGFRV
FT                   MLGAGLLLLGAPALALTVSQSMPCIVAVCLVRGLGFAFTLVAGGALTASLIPPELRGEG
FT                   LALIGVMAGVPSLVGLPLGAWLALHTEYGPVCSVAALIALVSIAAVPGLPGREATSAGS
FT                   RYLVAGRVNSLAGVDFAGHTEQSNGLRAVILAKVRAWSTAVTRRRRPGGVVSTPCTNGL
FT                   LQPPV"
     atggaaacgg cgagcctacg agcggctccg ccccctaggt ttcaccccat ggcctcatcc        60
     gccggtccgg aagaccgcga taccgaggcg cggtcgcgtc cggcgacccg cccgctgctg       120
     ttgcgcattg ttacggtcgt cggctcctcg gcgagcttct atctgctgct gtcggtcgtc       180
     cctgcgtacg cgcagagcgc acccggcggg ggcagcgaca aggcgggcct ggtcaccggt       240
     gcgctgatgc tggccacggt ggccggcgag ctgacagccc catggctggc cgcacgctgt       300
     ggctttcgcg tgatgctggg ggcggggttg ttgttgctgg gtgctccggc actggccctg       360
     accgtgtcgc agagtatgcc gtgcatcgtg gcggtgtgcc ttgtccgggg gctcggcttc       420
     gcgttcaccc tggtggcggg tggggcgctg acggcgtcgc tgatcccgcc cgaactccgc       480
     ggggaggggc tggccctgat cggcgtgatg gccggtgtgc cgtcgctggt gggcctgccg       540
     ctcggggcct ggctggcatt gcacacggaa tacgggcccg tctgctcggt ggcggcactg       600
     atcgccctgg tctccatcgc cgccgtcccg ggcctgcccg gccgggaagc gacgtcggct       660
     ggcagcaggt acctcgtcgc aggacgagtg aactcactgg ctggtgttga ttttgctggc       720
     catacggagc agtccaacgg gttgagggct gtgatcttgg ccaaggtaag agcatggtcg       780
     acagcagtga cgcgacgacg acgtcccgga ggagtcgttt cgacgccgtg cacaaatggg       840
     ctgctacagc cgccggtgta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page