(data stored in ACNUC7421 zone)

EMBL: BA000030.PE52

BA000030.PE52        Location/Qualifiers
FT   CDS_pept        complement(62965..63342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_52"
FT                   /old_locus_tag="SAV_52"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_52"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67761"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RU1"
FT                   /protein_id="BAC67761.1"
FT                   /translation="MHPIGGAGNAGVNDCPLYSVPVRIHSVTDSDARPEKTGEVVNKIK
FT                   KAAAVAVMVGGMALGGGAAHAAGGHGLDDPADIIIGNLQAVNCDQDFAGGAAFAPVQGI
FT                   STEGNTQNIGSFCTVVGPVYD"
     atgcacccaa ttggaggcgc cggaaatgca ggagtaaatg actgcccgtt atattctgta        60
     cctgtccgaa tacactccgt aacggattca gacgcgcgcc cagaaaaaac cggagaagta       120
     gtgaacaaga tcaagaaggc cgcggccgta gcggtcatgg tcggcggcat ggctctcggc       180
     ggcggggccg cccacgcagc cggcggccac gggctcgacg acccggccga catcatcatc       240
     ggcaacctgc aggccgtgaa ctgcgaccag gacttcgccg gcggcgccgc cttcgcaccc       300
     gttcagggca tctccaccga gggcaacacc cagaacatcg gcagcttctg cacggtggtc       360
     ggccccgtct acgactga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page