(data stored in ACNUC7421 zone)

EMBL: BA000030.PE521

BA000030.PE521       Location/Qualifiers
FT   CDS_pept        complement(659554..660030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_515"
FT                   /old_locus_tag="SAV_515"
FT                   /product="putative oxidoreductase with iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_515"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68225"
FT                   /db_xref="GOA:Q82QJ1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QJ1"
FT                   /protein_id="BAC68225.1"
FT                   /translation="MPMPSYSFVLNGERVTVEAPADMPLLWVLRDLLNVTGPKYGCGVG
FT                   VCRACTSHLDGGEIQPCVVPVADCADREVTTIEGLADGNRLHPVQQAWLDCDVAQCGFC
FT                   QPGQIMAAVALLKRTPRPSDADIDAIENVCRCGTYFRIREAIKKASVKFPRSGP"
     gtgccgatgc cgtcctattc cttcgtcctc aacggcgagc gggtcaccgt cgaggcgccg        60
     gccgacatgc cgttgctgtg ggtgctgcgc gacctgctga acgtcaccgg gcccaagtac       120
     ggctgcgggg tgggcgtctg ccgggcctgc accagccacc tcgacggcgg cgagatacag       180
     ccctgtgtcg tgccggtcgc cgactgcgcg gaccgcgagg tcaccaccat cgagggcctc       240
     gccgacggca accggttgca ccccgtgcag caggcctggc tcgactgcga cgtcgcccag       300
     tgcggcttct gccagccggg ccagatcatg gccgcggtgg ccctcctgaa acggacgcca       360
     cggccctccg acgccgacat cgacgccatc gagaacgtct gccgctgcgg cacgtacttc       420
     cgcatccgcg aggcgatcaa gaaggcttcg gtgaagttcc cccggtcagg cccatga          477
//

If you have problems or comments...

PBIL Back to PBIL home page