(data stored in ACNUC7421 zone)

EMBL: BA000030.PE528

BA000030.PE528       Location/Qualifiers
FT   CDS_pept        665728..665937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_522"
FT                   /old_locus_tag="SAV_522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_522"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68232"
FT                   /db_xref="InterPro:IPR025629"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QI4"
FT                   /protein_id="BAC68232.1"
FT                   /translation="MTTPAKGPVSYFPAIEKKYGRPIAEWKDIIRTSPLTKHMELVAWL
FT                   KAEHGLGHGHANALVAHTLAEGSR"
     atgaccacac cggcaaaggg cccggtcagc tacttccccg cgatcgaaaa gaagtacggc        60
     cgccccatag cggagtggaa ggacatcatc cgcacctcgc cgctgaccaa gcacatggaa       120
     ctcgtcgcct ggctcaaggc cgagcacggc ctgggccacg ggcatgccaa cgcactggtc       180
     gcacacacat tggccgaagg cagcaggtga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page