(data stored in ACNUC7421 zone)

EMBL: BA000030.PE537

BA000030.PE537       Location/Qualifiers
FT   CDS_pept        675606..676181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_531"
FT                   /old_locus_tag="SAV_531"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_531"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68241"
FT                   /db_xref="GOA:Q82QH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QH5"
FT                   /protein_id="BAC68241.1"
FT                   /translation="MRWLTLYARSRQIPASLAAVVISAVAVWALARNGSGGPGDPRLPA
FT                   LALATGTMAASIGLSGQDLALDRTAAIRWVPRRAAHVLLCGAVVGTALLTAQAMGEDMA
FT                   TTAFVVRDSAGLMGLVALGAALSGGRHAWTLPFAWLSFSFFAPPPTSVPMRVASWMLLP
FT                   PGTAAGTWTALVLAVVGTAAYAVAGPRR"
     gtgagatggc tgacgctgta cgcgcgctcg cgtcagatac ccgcgtcgct cgccgcggtg        60
     gtgatcagcg cggtggcggt gtgggcactc gcccggaacg gcagcggcgg gcccggtgat       120
     ccgcggctgc ccgcgctcgc cctcgctacg gggacgatgg cagcctcgat cgggctcagc       180
     gggcaggacc tcgcgctgga ccggacggcc gcgatccgct gggtgccccg cagagcggca       240
     catgtactgc tctgcggtgc ggtcgtcggc acggcgctgc tgacagcgca ggcgatgggt       300
     gaggacatgg ccaccaccgc gttcgtcgtc cgggacagcg cgggcctgat gggactggtc       360
     gccctgggcg cggcgctctc gggcggccgg cacgcctgga cgctgccgtt cgcctggctc       420
     tcgttctcgt ttttcgcccc gcccccgacg agtgtgccga tgcgggtggc gagctggatg       480
     ctgctgccgc ccggcacggc agcgggcacc tggacggccc tggtcctcgc ggttgtcggc       540
     accgcggcct acgccgtcgc gggaccgaga cggtga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page