(data stored in ACNUC7421 zone)

EMBL: BA000030.PE538

BA000030.PE538       Location/Qualifiers
FT   CDS_pept        676319..676693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_532"
FT                   /old_locus_tag="SAV_532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_532"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68242"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QH4"
FT                   /protein_id="BAC68242.1"
FT                   /translation="MVVATPAKGKRLTDAVGAQNIAFSRPAGERVTAFGCPATTPQRGE
FT                   ELLYCPGNSQRAPEGEQRVPCDLGGGASGGPWLAGFNSAAGKGTVVSVNSDGEGDGGTP
FT                   MYGPTLDKTARAVYDAAQRG"
     atggtcgtcg ccactccggc caaggggaag cggctcaccg acgcagtggg ggcgcagaac        60
     atcgccttca gccgtccggc cggtgagcgg gtcaccgcct tcggctgtcc ggcgaccact       120
     ccccagcggg gcgaggaact gctgtactgc cccggcaact cccagcgcgc ccccgagggc       180
     gagcagcgcg tcccgtgcga cctcggcggc ggcgcgagcg gcggtccctg gctcgccggc       240
     ttcaactccg ccgccggcaa gggcaccgtg gtgtcggtca acagcgacgg cgagggcgac       300
     ggcggcaccc cgatgtacgg gccgacgctc gacaagaccg cgcgggccgt ctacgacgcc       360
     gcccagcgcg gctga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page