(data stored in ACNUC7421 zone)

EMBL: BA000030.PE54

BA000030.PE54        Location/Qualifiers
FT   CDS_pept        complement(64481..64588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_54"
FT                   /old_locus_tag="SAV_54"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_54"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67763"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RT9"
FT                   /protein_id="BAC67763.1"
FT                   /translation="MWPGARGIGRGAGRTGRGIAPLLPQGERRFSVTGP"
     gtgtggccgg gggcgcgggg catcggccgt ggagcgggcc ggacgggccg tgggattgcc        60
     ccgctcctgc cgcagggcga gcggcgcttt tcggtgaccg ggccgtag                    108
//

If you have problems or comments...

PBIL Back to PBIL home page