(data stored in ACNUC7421 zone)

EMBL: BA000030.PE542

BA000030.PE542       Location/Qualifiers
FT   CDS_pept        complement(678456..678746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_536"
FT                   /old_locus_tag="SAV_536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_536"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68246"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QH0"
FT                   /protein_id="BAC68246.1"
FT                   /translation="MINLQVRHESGTVLAGSGHGVAWDESLAEIDRSQFPMLAGVCPFA
FT                   DTVFNTWQLPMLVEELDRLPAARGGPWVDAVRALCRTAEEGSHRYVWFVGD"
     atgatcaacc tgcaggttcg tcacgagtcc gggaccgttc tggctgggtc cgggcatggc        60
     gtcgcctggg acgagtcgct cgcagagatc gaccggtcgc agttccccat gctcgccggt       120
     gtctgcccgt tcgcggatac cgtcttcaac acctggcagc tccccatgct ggttgaggag       180
     ttggaccgtc tgcccgcagc gcgaggtggt ccctgggttg acgcggtgcg agccttgtgc       240
     cggactgcgg aggaaggctc ccatcgatac gtctggttcg ttggtgactg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page