(data stored in ACNUC7421 zone)

EMBL: BA000030.PE544

BA000030.PE544       Location/Qualifiers
FT   CDS_pept        680351..680782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_538"
FT                   /old_locus_tag="SAV_538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_538"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68248"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QG8"
FT                   /protein_id="BAC68248.1"
FT                   /translation="MDFELIEGAPEFGCLIAEVEETGERIRLTADGEPAGVLLAAAELA
FT                   TLEYWAARHNKGARPQDEPADEYPPGPTSYGPYIGYSHPHGGMTLTRGRLVVAELRDAE
FT                   TVAWLEEQAMYGRQGYMGPKQSAAFAEFLARQTPVGDEH"
     atggactttg aactgataga aggagcgccc gagttcgggt gtctgatcgc cgaggtcgag        60
     gagaccggcg agcgcatccg gctcaccgcg gacggcgagc cggcgggggt gctgctggcg       120
     gcggccgagc tggcgacact ggagtactgg gccgcacgtc acaacaaggg cgcgcggccg       180
     caggacgagc cggcagacga gtacccgccg gggccgacgt cgtacgggcc ttacatcggc       240
     tacagccacc cgcacggcgg gatgaccctc acgcggggcc ggctggtcgt ggcagagctg       300
     cgtgacgccg aaacggtggc gtggttggaa gaacaggcga tgtatggccg tcaggggtac       360
     atggggccga agcagtcagc agcattcgcc gagttcctcg cccgtcagac gccggtcggc       420
     gacgagcact ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page