(data stored in ACNUC7421 zone)

EMBL: BA000030.PE545

BA000030.PE545       Location/Qualifiers
FT   CDS_pept        complement(681371..682687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_539"
FT                   /old_locus_tag="SAV_539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_539"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68249"
FT                   /db_xref="GOA:Q82QG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QG7"
FT                   /protein_id="BAC68249.1"
FT                   /translation="MTNSLGPDSGSRSGSHVMVRRGLTKSKCAQAEMVWVALVLLLTAL
FT                   PVGWCGLKDFKDALTFPGCVTGAALMVAALIMLVGVAAVVDCWIRGPISNFGVVALIST
FT                   GVALLTNVLLAFQTWNDGERVVYKVLSIVLSVGSLLAVIQVWRRLDEIPTPKRVAAALI
FT                   VSTIVAVANFSYQYLFQPHRREVAPLVQLNVGKAVLSADRKAFSVPVDIKLVNHSDVSF
FT                   YVLGAEFHAMGEDVTVSPTDLDRSKWREGAEQWARYREKHPLTRREVYQPGKLVAAQQW
FT                   IPAGHWVEAKDEALTRTVVQLPIDTHFDKLTFYATLSLARKDRLVMGNFGRPGYSWRGV
FT                   ELPHWVKAGQEDNDTIIQTADMQENNAIDHYTRESRRVTTYWRFGLHGVDVAPVIVPVG
FT                   EEGRTFSEQTNREVRNRYGLIDVLAGPVEQTLDEIKSRR"
     gtgacgaatt ctttagggcc cgactcaggg tcccgctccg gctcgcacgt gatggtgcga        60
     cggggcctga cgaaatccaa atgcgcgcag gcggaaatgg tatgggttgc gctggtcctg       120
     ctcctgacgg cgctgccggt gggctggtgc ggcctcaagg acttcaagga tgctctgact       180
     ttcccgggtt gcgtcaccgg agcggccctc atggtggcgg ccctcatcat gctcgtgggt       240
     gttgccgcgg tcgtggactg ttggatccga gggccgattt ccaactttgg agtggtcgcg       300
     ctgatcagta ccggcgtggc gttgttgacg aacgtcttgc tcgcgtttca gacatggaat       360
     gacggcgaga gagtcgtcta caaggtactg tccattgtgc tcagcgtggg ttcgctattg       420
     gctgtcatcc aggtgtggcg aagactggat gagatcccca ctcccaagcg ggtggctgcg       480
     gcactcattg tctccacgat cgtggcggtc gccaatttca gctaccagta tctctttcag       540
     ccgcaccggc gcgaggtcgc cccgctcgtg cagctgaacg tgggcaaggc ggtgctcagt       600
     gcggaccgca aggcgttctc cgtgccggtc gacatcaagc tcgtgaacca cagtgatgtg       660
     agtttctatg tgctgggcgc cgagttccac gccatgggag aggacgtgac ggtgagcccg       720
     acggacctgg accgctcgaa gtggcgggag ggcgccgagc aatgggccag ataccgggag       780
     aagcacccgc tcacccgcag ggaggtctac cagcccggca agctggtggc ggcgcagcag       840
     tggattcccg ccggacactg ggtcgaggcg aaagatgagg cgctcacgcg aaccgttgtt       900
     cagcttccca tcgacacgca tttcgacaag ctgacgttct acgccaccct gagcctggcg       960
     cgtaaagacc ggctcgttat gggaaatttc ggaaggcctg gttactcctg gcggggcgtc      1020
     gagctgcccc attgggtgaa ggcagggcag gaggacaacg acaccatcat ccaaacggcc      1080
     gatatgcaag aaaacaatgc gatcgatcat tatacgagag aatcgcgccg cgtcactacc      1140
     tattggcgct ttggtctaca tggtgtagac gtggcgccgg tcatcgtgcc ggtgggtgag      1200
     gaaggtcgca cattctccga acagacgaac cgcgaggtgc ggaaccgcta cggtctgatc      1260
     gacgtcttgg cgggcccggt cgaacagacg ctggacgaga tcaagagccg gcgctga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page