(data stored in ACNUC7421 zone)

EMBL: BA000030.PE548

BA000030.PE548       Location/Qualifiers
FT   CDS_pept        685826..686794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_542"
FT                   /old_locus_tag="SAV_542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_542"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68252"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QG4"
FT                   /protein_id="BAC68252.1"
FT                   /translation="MGPWRDPTSAQALAVSLRPSGRSHRPTQVRRPPMAAGASNSTANA
FT                   DWGKANFNDIYNCPDPRPYFATLRSLEYQIPHHGQAVFRALTYALRWLHPDRTPLNVVD
FT                   LCCSYGINTALLNCRVTLSDLSTRYTSHHLSALPTRQLAAEDRTFFAARRRPEAATATG
FT                   IDSAALAVGYARAVGLLDHAFAENLEVTEPSPALRRTLAGTDLITVTGGVGYVFTRTFT
FT                   RLLDCMPTPPWVAAFVLRTVPYQPIADLLARSGLVTEKLSARTFRQRRFADSAERYAAF
FT                   HALAVNGLHTADKEADGFYHTDLYVSRPAPDIAALPLARLL"
     gtggggccgt ggcgcgaccc gacgagcgca caggcgctgg ccgtatccct gcggccatcg        60
     ggtcgttccc accggccgac gcaggtcagg agaccgccca tggcagcagg agcgagcaac       120
     agcaccgcga atgccgactg gggcaaagcc aacttcaacg acatctacaa ctgccccgac       180
     ccccgcccgt acttcgcaac cctgcgatcc ctcgagtacc aaatacccca ccatgggcag       240
     gccgtcttcc gggcactgac ctatgctctg cgctggctgc accccgaccg gacgccactg       300
     aacgtggtgg acctgtgctg ctcctacggg atcaacacag ctctcctcaa ctgccgtgtc       360
     actctgtcgg acctgtccac ccggtacacc tcccaccacc tctccgccct gccaacccgg       420
     caactcgcgg ccgaggaccg gaccttcttc gcagcgcgcc gccgcccgga agccgcaacg       480
     gcgacaggca tcgactcggc agccctggcc gtcggatacg cccgcgccgt cggcctactc       540
     gaccacgcct tcgcggagaa cctcgaagtc accgaaccga gccccgccct gcgccgcaca       600
     ctggcgggca cggacctcat caccgtcaca ggcggcgtcg gctacgtctt cacccggacc       660
     ttcacgaggc ttctcgactg catgccgacc ccaccgtggg tcgcggcgtt cgtgctgcgc       720
     accgtgccct accagccgat cgccgacctg ctcgcacgct cgggcctggt gacggagaaa       780
     ctgtccgccc gtaccttccg gcagcgccgc tttgccgaca gcgccgaacg gtacgcggcg       840
     ttccacgccc tggctgtgaa cggactgcac acggcagaca aggaagcgga cggcttctac       900
     cacaccgacc tgtatgtctc ccggcccgct cccgacatcg cggcgctgcc tctcgcacgc       960
     ctgctgtaa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page