(data stored in ACNUC7421 zone)

EMBL: BA000030.PE55

BA000030.PE55        Location/Qualifiers
FT   CDS_pept        complement(64632..65045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_55"
FT                   /old_locus_tag="SAV_55"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_55"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67764"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RT8"
FT                   /protein_id="BAC67764.1"
FT                   /translation="MTLTATVTCSADPSRVLLGLTFFDGGDILGEVSVDSSGHAQYTTT
FT                   FATTGTHTITAAYNGNANCFASNSMTTVQVSAAPVPPTPPGHGLCRDDCCGLINIHLGG
FT                   IKTSVGVDRVRSSLARWLTPRLPYPARLQGLTR"
     gtgacactga ccgcgaccgt gacctgtagc gctgacccca gcagagtcct tctcggcctg        60
     acgttcttcg acgggggaga catcctgggt gaggtgtccg tcgactcgag cgggcacgcg       120
     cagtacacga ccaccttcgc caccaccggc actcacacga tcacggccgc gtacaacgga       180
     aacgcgaact gcttcgcttc gaacagcatg accacggtcc aggtctccgc ggcgccggta       240
     cccccgactc cgccggggca cgggctctgc cgcgacgatt gctgcggcct gatcaatatt       300
     catctcggtg gcatcaagac cagcgtcggt gtcgaccggg tcaggtcctc gctggcgcgg       360
     tggctgacgc cccgtctgcc gtacccggcc cgcttgcaag gcctcacacg gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page