(data stored in ACNUC7421 zone)

EMBL: BA000030.PE553

BA000030.PE553       Location/Qualifiers
FT   CDS_pept        complement(692180..693268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_547"
FT                   /old_locus_tag="SAV_547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_547"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68257"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QG0"
FT                   /protein_id="BAC68257.1"
FT                   /translation="MTGAPPQEREPVTTSGTIAVTNLHGQIDGLAVRLSRADTGETSAA
FT                   PLAVAQGAALIDLLNLRGHILGRVADYERAAELAEQLVHVAPEDGTALLARARTRATLH
FT                   RFAEAVADLGAAGRNGAEEATVDAERAVVLQALGCYADAMALIRKAAERQSDFTTLGAL
FT                   AVLQAERGEVSEAERLFGEARRHYQGTSPFPLAQLDFRRGVMWHREGDLDAARSCYEAA
FT                   RRRVPDYAPALGHLAEVELLRDDPQAAVALLRPLTWASDDPEYAGHLAAALHACDRFQE
FT                   ANQWRERAAARYGELVLRHPEAYADHAADFWLTVGADAERGLQLALQNLAFRQTARAHA
FT                   LFQRAVLAQNRVAQNRVAQAAP"
     atgaccgggg cgcctcccca ggagagggag ccggtcacga cgagcggcac catcgccgta        60
     acgaatctgc acgggcagat cgacggcctg gccgtacggc tcagccgtgc ggataccggg       120
     gagacgtcgg cggctccgtt ggcggtggcg caaggggcgg ccctgatcga cctcctcaac       180
     ctccgaggcc acatcctggg ccgcgtcgcc gactacgagc gggccgcgga actcgctgag       240
     cagctcgtgc acgtcgctcc cgaggacggc acggccctgc tcgcccgcgc caggacgcgg       300
     gcgaccctgc accgcttcgc cgaggccgtt gccgacctcg gcgcggcggg ccggaacggc       360
     gcggaggagg ccacggtgga cgcggagcga gccgtcgttc tgcaggccct cggctgctac       420
     gcggatgcca tggccctgat ccgcaaagcg gcggagcggc agagtgactt cacgacgctc       480
     ggcgcgctcg ccgtactcca ggccgagcgg ggggaggtca gcgaggcgga gcggctgttc       540
     ggcgaggcgc ggcgccacta tcaggggacc tcaccgtttc cgctcgccca gctggacttc       600
     cgacgcggtg tgatgtggca ccgcgagggc gatctcgatg cggcccgctc gtgctacgag       660
     gccgcccggc gccgggtgcc cgactacgcg ccggcactgg gccacctggc cgaggtcgag       720
     ctgctgcgcg acgaccctca ggccgccgtc gccctcctgc gtcccctcac ctgggccagc       780
     gacgaccccg agtacgccgg ccacctcgcg gccgcgttgc acgcatgcga caggtttcag       840
     gaggcgaacc agtggcgcga gcgcgcggcg gcgcgttacg gcgaactggt gctgcgtcac       900
     ccggaggctt acgccgacca cgcggccgac ttctggctca cggtgggggc cgatgccgag       960
     cgggggctcc aactggcgct gcagaacctc gcattccgcc agacagcccg agcccatgcc      1020
     ctgttccagc gcgctgtcct cgcgcagaac cgggttgccc agaaccgggt tgcacaggct      1080
     gccccatag                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page