(data stored in ACNUC7421 zone)

EMBL: BA000030.PE558

BA000030.PE558       Location/Qualifiers
FT   CDS_pept        complement(697702..699213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_552"
FT                   /old_locus_tag="SAV_552"
FT                   /product="putative transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_552"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68262"
FT                   /db_xref="GOA:Q82QF6"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QF6"
FT                   /protein_id="BAC68262.1"
FT                   /translation="MSQNTVAAARGVETAPKNGAVDPSHQRRWWILVVISLAQLMGVLD
FT                   GTIVNIALPSAQRELGFSDADRQWVVTAYALAFGSLLLLGGRVADLVGRKVTFLVGLAG
FT                   FAAASMVGGAANGFGMLVAARAVQGGFAALLAPSALSLLMTTFTDPRERAKAFTVAGSV
FT                   AGAGGAIGLILGGVLTEYLDWRWTMYVNVVFAVVAFAGGAALLRRTSRDTSSKLDIPGT
FT                   LLVSAGLFCLVYGFSNAETHGWGSVATWGMLAAGTVLVGLFGWWQSKAAYPLLPLRVLL
FT                   DRNRGASFAALFVSGAGMFGVFLFLTYYLQQSLGYSALKTGFAFLPMIVASSSASAVAA
FT                   NVLVPRIGPKPVVPLGMAIAAVGLVWMTALDLNSGYVTQVLPQLVLVGIGLGAVIAPAM
FT                   SLATSGVAAADAGAASAAVNTVQQVGGSIGVALLSTMASDAVTDYLSGRNPKDPDVLAQ
FT                   AGLEGYSTAYWWSAAVFVIGLGVTALLYRRGVPQQDENAAPVVHM"
     atgtcgcaga acaccgtcgc cgccgctcgc ggcgttgaga ccgcaccgaa gaatggggct        60
     gtcgacccgt cacaccagcg ccgctggtgg attctggtgg tcatttccct cgcccaactg       120
     atgggagtcc tcgacggcac catcgtgaac atcgctctgc cgtccgccca gcgcgagctg       180
     ggcttctcgg acgccgaccg gcagtgggtg gtcaccgcct atgcgctggc cttcggcagc       240
     ctgctactgc tcggcggccg ggtcgcagac cttgtcgggc ggaaggtgac cttcctggtg       300
     ggtctggccg gtttcgcggc cgcttccatg gtgggaggcg cggcgaacgg attcggcatg       360
     ctcgtcgccg cgcgcgcggt ccagggcggg ttcgccgccc tgctggcccc gtccgcgctg       420
     tcgcttctga tgaccacctt caccgatccg cgcgagcgtg cgaaggcctt caccgtcgca       480
     ggctcggtcg ccggtgcggg tggcgccatc ggcctgatcc tcggcggggt gctgaccgag       540
     tacctggact ggcgctggac catgtacgtc aacgtggtct tcgcggtggt ggcgttcgcc       600
     ggtggcgcag ccctgctgcg ccgcacctcg cgggacacgt cctcgaagct cgacatcccc       660
     ggcaccttgc tggtctccgc cggcctgttc tgcctggtct acggtttctc gaacgccgag       720
     acgcacggct ggggttcggt ggcgacgtgg ggcatgctcg cggccggtac cgtcctggtg       780
     ggcctcttcg gctggtggca gagcaaggcg gcatatccac tgctgcccct gcgggtcctg       840
     ctggaccgta accgcggcgc ctccttcgct gccctcttcg tcagcggggc gggcatgttc       900
     ggcgtgttcc tgttcctgac ctactacctg cagcagagcc tcggttacag cgccctgaag       960
     accggcttcg ccttcctgcc catgatcgtg gcctcgtcgt ccgcctccgc cgtggccgcc      1020
     aacgtcctgg tgccgcgcat aggccccaag ccggtggtac cgctgggcat ggccattgcg      1080
     gccgtcggcc tggtctggat gaccgcgttg gacctgaaca gcggatacgt gacgcaggta      1140
     ctgccacaac tggtgctcgt cggcatcggg ttgggcgcgg tcatcgcgcc cgcgatgagc      1200
     ctggccacct ccggcgtggc ggcggccgac gccggggcgg cgtccgccgc cgtcaacacc      1260
     gtccagcagg tcggcgggtc catcggcgtc gccctgctca gcacgatggc ctccgacgcc      1320
     gtcaccgact acctctccgg ccgcaacccc aaggaccccg acgtcctggc ccaggccggc      1380
     ctcgagggct actccactgc ctactggtgg tcggcggccg tcttcgtcat cggcctgggc      1440
     gtgaccgccc tgctctaccg ccgcggcgtg ccgcagcagg acgagaacgc cgcgcctgtc      1500
     gttcacatgt ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page