(data stored in ACNUC7421 zone)

EMBL: BA000030.PE56

BA000030.PE56        Location/Qualifiers
FT   CDS_pept        complement(65216..65398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_56"
FT                   /old_locus_tag="SAV_56"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_56"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67765"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RT7"
FT                   /protein_id="BAC67765.1"
FT                   /translation="MPRCTREPSPVTVQDSANNASRPRCARWPKWVDWAGASLGRESPR
FT                   RSVRLPDRLRRTFVL"
     gtgccaaggt gcacgagaga gccgtccccc gtgaccgtcc aggactctgc gaacaacgct        60
     tcccgccccc gctgtgcccg ttggcccaag tgggttgact gggccggcgc ctccctgggg       120
     cgcgagagcc ctcggcgtag cgtgaggctc ccggaccggt tgcggcggac ctttgtcctg       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page