(data stored in ACNUC7421 zone)

EMBL: BA000030.PE564

BA000030.PE564       Location/Qualifiers
FT   CDS_pept        707738..708082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_558"
FT                   /old_locus_tag="SAV_558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_558"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68268"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QF1"
FT                   /protein_id="BAC68268.1"
FT                   /translation="MPGTPRTPNDAANGAPAKTSARRSRTRIGRLPCGNAARATSSVRS
FT                   GIFGNPSGCRDIHTTHTTARQVNGRADDHPAPTACPPQPRGIAQQSPGPPQATSWPLSR
FT                   PAHPGRDQIR"
     atgcccggaa ccccgcgcac gccgaacgac gcggcaaacg gtgcgccagc gaagacttcc        60
     gcgagacggt cccgcacccg tatcggcaga ctgccgtgcg ggaacgcggc ccgggccacc       120
     agctcggtcc gctccgggat cttcggcaac ccctccggct gccgcgacat ccacaccacc       180
     cacacgaccg cacgacaggt caacggccgc gcagacgatc accccgcacc cacggcctgc       240
     ccaccccagc cccgcggaat tgcgcagcag agtcccggtc cgccgcaagc cacgtcttgg       300
     ccgctcagca ggccggcaca cccaggccgc gaccagatcc ggtga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page