(data stored in ACNUC7421 zone)

EMBL: BA000030.PE57

BA000030.PE57        Location/Qualifiers
FT   CDS_pept        complement(65536..66591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_57"
FT                   /old_locus_tag="SAV_57"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_57"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67766"
FT                   /db_xref="GOA:Q82RT6"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR031148"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RT6"
FT                   /protein_id="BAC67766.1"
FT                   /translation="MKDSPPAAGAVRPAAVVAAVPVLTSVVPSTGPAAGNNNVTLNGSG
FT                   FSGVTAVLFGTKPALGYTVDSTTKITAVAPSGTGTVAVTVKTPGGTSNSVAYTYAAQPS
FT                   LTSVSPSQGPSSGGTTVILTGTGLSAATAVTFGSTPAAGYTVNSATQITAVAPAGTGAV
FT                   PITVTTPGGTTGPVYFFYVNAPTVTSVSPGQGPASGGTTVILTGADLSAATAVTFGSTP
FT                   ATGYTVNSPSQITAVAPAGTGSVAVTVTGPGGVSNSVIYTYVASPVLSSLVPVLGPTGA
FT                   GAGVTLTGSGLTTTTAVRFGAVSAAFTVLSDTTVAAYAPAGVPGPVLVNVTTAGGTSNS
FT                   LTYTRVAPPVI"
     gtgaaagaca gccctcctgc ggcaggagca gtccggcccg ccgccgttgt cgccgccgtt        60
     cctgttctca cctcggtcgt acccagtacg ggccctgcgg caggcaacaa caacgtcacc       120
     ctgaacggca gcggcttctc gggagtcacc gccgtcctgt tcggcaccaa accggccctc       180
     ggatacacgg tcgactccac gacgaagatc accgcggtgg ccccgtccgg caccggcacc       240
     gttgccgtga ccgtcaaaac acccggaggg accagcaact cggtcgccta cacctacgcg       300
     gcacagccct ccctgacctc cgtttcgccg agccaggggc cgtcttcggg cggcaccacc       360
     gtcatcctca ccggaacggg cctgagcgca gccaccgcgg tcaccttcgg cagcacaccc       420
     gccgccggct acaccgtcaa ctccgccaca cagatcaccg ccgtcgcccc ggcgggaaca       480
     ggcgccgtgc ccatcaccgt caccacgcct ggcggtacga ccggccctgt ctacttcttc       540
     tacgtcaacg cgcccacggt cacctccgtc tcgccgggcc aggggccggc ttcgggcggc       600
     accaccgtca tcctcacggg ggcggatctg agcgcagcca ccgcggtcac cttcggcagc       660
     acgcccgcca ccggctacac cgtcaactct cccagccaga tcaccgctgt cgccccggcg       720
     ggaacgggct cggtcgccgt gaccgtcacg ggcccgggcg gcgtcagcaa ctcggtcatc       780
     tatacgtatg tggcgtcacc ggtcctcagc tcccttgtcc ccgtccttgg gcccaccggc       840
     gccggagccg gtgtcacgct caccggcagc ggcctgacca ccacgaccgc cgtccgtttc       900
     ggtgccgtat ctgcggcctt caccgtgctg tccgacacca cggtcgccgc gtacgccccg       960
     gcgggggtgc ccggccccgt cctggtcaac gtgaccacgg ccggcggcac cagcaactcc      1020
     ctcacctaca cacgtgtcgc ccctcccgtg atctag                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page