(data stored in ACNUC7421 zone)

EMBL: BA000030.PE578

BA000030.PE578       Location/Qualifiers
FT   CDS_pept        complement(723643..724497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_572"
FT                   /old_locus_tag="SAV_572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_572"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68282"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QD7"
FT                   /protein_id="BAC68282.1"
FT                   /translation="MTSASERGRRPLRVGNCSGFYGDRASAMADMARAGGIDVLTGEYL
FT                   AEVTMLVLGKARAKDSTKGFAITFLQHLDAAREHLVANRIRLVVNAGGLHPAGLAAATR
FT                   ELIARHGHDLRVSHIEGDDVFGSLDGLGQAGHCLPHLTSGQPLSDWPHQPVQMVKEDAG
FT                   DLGEMVDLLCCERVDEQAPHYLGMALGAASSKAVRPSGVSAAYMARDGPLWRSTRPRLH
FT                   RRVSWWWRRLSPSPAQLIAELICTHGPARGFRQGDERRVIGVGCGSLEGNACAELGRHE
FT                   ASA"
     atgacgtcag catcagaacg gggccgacgc cccctccgcg tcgggaactg ctccggcttc        60
     tacggcgacc gcgcctcggc catggccgac atggcccgag cgggcggcat cgacgtcctc       120
     acgggtgaat acctcgccga ggtcacgatg ctggtcctcg gcaaggcgcg cgccaaggac       180
     agcacgaagg gctttgcgat caccttcctg cagcacctcg acgcggcgcg cgagcacctc       240
     gtcgccaacc ggatcaggct cgtcgtcaac gccggaggac tccaccccgc cgggctggcc       300
     gccgcgacgc gcgaactgat cgcacgccac ggtcacgacc tgcgggtctc ccacatcgaa       360
     ggcgacgacg tcttcggcag cctcgacggt ctggggcaag cgggccattg cctgccgcac       420
     ctgacgagtg gtcagccgct gtcggactgg ccgcaccagc cagtgcagat ggtcaaggaa       480
     gacgctggag atctcggcga gatggtcgat ctgctctgct gtgagagggt cgacgaacag       540
     gcgccgcact acctgggcat ggctttgggg gctgcttctt ccaaggctgt gcgtccttct       600
     ggcgtgagcg ccgcatacat ggcgcgtgac ggtccgctct ggcgctccac caggccgcgc       660
     ttgcacaggc gggtgagctg gtggtggagg cggctctctc ccagcccagc ccagctcatc       720
     gctgagctca tatgcacgca tgggcccgcc cggggtttcc gacagggcga cgagcgccgt       780
     gtgatcggcg ttggctgcgg atccttggaa gggaacgcgt gtgctgagct gggccgtcat       840
     gaagcgtcag cgtag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page