(data stored in ACNUC7421 zone)

EMBL: BA000030.PE58

BA000030.PE58        Location/Qualifiers
FT   CDS_pept        complement(66803..67546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_58"
FT                   /old_locus_tag="SAV_58"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_58"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67767"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RT5"
FT                   /protein_id="BAC67767.1"
FT                   /translation="MPISPNQGSSGGGTLVTITGTNLTGTSAVRFGTRSATNVTNVSPT
FT                   TVTAVSPSGSGSVGVTVTTPGGTSNPIPFYYVGAPFKQTLSPTSGSTAGGTTVTITGTG
FT                   FSSATSVAFGANTVAPTVVSDSQLTAVAPAGAAGSVGVSVTTAGGTNNGLSYTYVAVPT
FT                   VTSVVPDEGPVSGGTSVTVTGTGLTSTSQVTFDGNPAPFTVISDTALSAVTPPGAAGLV
FT                   DVVVTNDAGSATATDAFTYLAGPGI"
     atgcccatct ctccgaacca aggatccagt ggtggcggca cacttgtcac catcaccggc        60
     accaatctca ccggcaccag cgccgtgcgc ttcggcacgc ggtccgccac caacgtcacc       120
     aacgtctcgc ccaccacggt caccgcggtc tcgccctccg gcagcggttc ggtcggtgtc       180
     accgtgacca ctccgggagg gacgagcaac cccattccgt tctactacgt gggggcgccg       240
     ttcaagcaga ccctgagtcc gacctccggg tcgaccgcgg gcggcacgac cgtcaccatc       300
     accggcaccg gcttctccag tgccaccagc gtcgccttcg gcgcgaacac ggtggcgccg       360
     acggtggtgt ccgacagcca gctcaccgcc gtcgcgccgg ccggtgcggc cggctcggtc       420
     ggtgtcagcg tcaccaccgc gggcggtacc aacaacgggc tctcgtacac ctatgtcgcc       480
     gtcccgacgg tgacgtcggt cgtcccggac gaggggccgg tgtcgggcgg cacctcggtg       540
     accgtgaccg gtaccggtct caccagcacc agccaggtca ccttcgacgg caacccggca       600
     cccttcacgg tgatctccga caccgcgctg tcggctgtca cgcctcccgg ggccgccggt       660
     ctcgtcgatg tcgtcgtgac caacgacgcg ggcagcgcga ccgccacgga cgcgttcacc       720
     tacctcgccg gccccggcat ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page