(data stored in ACNUC7421 zone)

EMBL: BA000030.PE585

BA000030.PE585       Location/Qualifiers
FT   CDS_pept        complement(734105..734434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_579"
FT                   /old_locus_tag="SAV_579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_579"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68289"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QD1"
FT                   /protein_id="BAC68289.1"
FT                   /translation="MSQYQLRVYTLRSPEALVAYENIWSQHIPGMAKHRITTHGVWTVP
FT                   AAPGSEEPQLYALVSYRDADDVQERLEAYLSSPEFRADMEGFDISQIVGVAESVLTPTA
FT                   DSPLR"
     atgtcccagt accagcttcg tgtctacacc ctgcgcagcc ctgaggcgct cgtcgcctac        60
     gagaacatct ggtcccagca cattcccggt atggccaagc acaggatcac cacacacggc       120
     gtttggacgg tgcctgcggc ccccgggagt gaggagcccc agctgtacgc cctcgtttct       180
     taccgggacg ccgacgacgt tcaggagcgg ctggaggcgt acctgtccag ccccgaattc       240
     cgggcggaca tggagggctt cgacatcagc cagatcgtcg gcgtcgccga gtccgtgctg       300
     acgcccaccg ccgactcacc cttgcggtga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page