(data stored in ACNUC7421 zone)

EMBL: BA000030.PE612

BA000030.PE612       Location/Qualifiers
FT   CDS_pept        complement(760605..761123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_606"
FT                   /old_locus_tag="SAV_606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_606"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68316"
FT                   /db_xref="InterPro:IPR022598"
FT                   /db_xref="PDB:5WSX"
FT                   /db_xref="PDB:5WSY"
FT                   /db_xref="UniProtKB/TrEMBL:Q79ZR9"
FT                   /protein_id="BAC68316.1"
FT                   /translation="MTTAQHPTDEDLLARVLVPYKDHCKYLRSAVVTESDTGRAVARCE
FT                   FAIPESCYIDDTGHLNSVEVNICYNQMMYYLVAKSVKEGLLAGFESWTLDDFWKHQLPD
FT                   ILIARFASNFRRPVNPRAFSGEMEFQSVTRRAPAGGIPFLHAETAYRYWDADSGRCDGE
FT                   AVLAFVNIP"
     atgacgacgg cccagcaccc cacggacgag gacctgttgg cgcgcgtgct ggtgccctac        60
     aaggaccact gcaagtatct gcgctcggcc gtcgtgaccg agagcgacac cggacgggcc       120
     gtcgcccgct gcgagttcgc gattccggag tcgtgctata tcgacgacac cggccatctg       180
     aattccgtcg aggtgaacat ctgctacaac cagatgatgt actacctcgt cgccaagtcc       240
     gtgaaagaag ggctcctggc ggggttcgaa tcctggacgc tggacgactt ctggaagcat       300
     cagctcccgg acatcctgat cgcccgcttc gcctccaact tccggcggcc cgtcaaccca       360
     cgtgcattct ccggggagat ggaatttcag tccgtcaccc ggcgcgcccc cgcaggcggc       420
     atcccgttcc tgcacgccga gaccgcctac cgctactggg acgccgactc gggccggtgc       480
     gacggcgagg ccgtcctggc gttcgtcaac atcccctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page