(data stored in ACNUC7421 zone)

EMBL: BA000030.PE619

BA000030.PE619       Location/Qualifiers
FT   CDS_pept        767298..767819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_613"
FT                   /old_locus_tag="SAV_613"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_613"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68323"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QA7"
FT                   /protein_id="BAC68323.1"
FT                   /translation="MEPRSLMRVMRPTRNTWFVNALRTVAPPLGASCGALALMVAYTAT
FT                   GAAGDPPPRITVVDAHIVAVSAGSGSTAAYFEIRNTGPSKDTLLYADSPDLGVSLLRRT
FT                   VRRTGTGRTEPVWAVDVPAGGTVRMAPGGLGVVILDPPVLKAGQKVPYLLWFRQSGKVA
FT                   VRATVTAGVR"
     atggagccga gaagcctgat gcgtgtgatg cgcccgacgc gcaacacatg gttcgtcaac        60
     gccttacgga ccgtcgcgcc gccgttgggc gcctcctgcg gtgcgctggc cctcatggtc       120
     gcgtacaccg cgaccggcgc ggcaggcgat ccgccgccca ggatcacggt cgtcgacgca       180
     cacatcgtcg cggtgtccgc gggttccggc tcgaccgccg cgtatttcga gatccgcaac       240
     accggcccgt cgaaggacac gctgctgtac gcggactcac cggacctggg cgtcagcctc       300
     ctgcgacgta cagtgcgccg caccgggacg gggcgtacgg agcccgtgtg ggccgtcgac       360
     gttccggcgg gcggcacggt gcgcatggcg ccgggaggtc tcggggtcgt gatcctggat       420
     ccccccgtac tgaaagccgg tcagaaggtg ccctaccttc tgtggttccg tcagagcggg       480
     aaggtcgccg tccgggcgac cgtgaccgcg ggcgtgagat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page