(data stored in ACNUC7421 zone)

EMBL: BA000030.PE625

BA000030.PE625       Location/Qualifiers
FT   CDS_pept        complement(773199..773498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_619"
FT                   /old_locus_tag="SAV_619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_619"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68329"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QA1"
FT                   /protein_id="BAC68329.1"
FT                   /translation="MPSSQLHVCRVAWPACSNGRGGTLVDVVRVMEALAEQGVTVLFKA
FT                   DAERMRDGVRPWTFVANGLPFHEDLLVRTDAASVEACLKICLPQLRARGLVIPE"
     atgccgtcaa gtcagctgca tgtgtgccgt gtagcgtggc ccgcctgttc gaacgggcgg        60
     ggtgggacgt tggtcgacgt ggtgcgtgtc atggaggcgc tggccgagca gggcgtcacg       120
     gtgctgttca aggcggacgc ggaacgcatg cgtgacggag tgagaccgtg gaccttcgtc       180
     gcgaacggtc tccccttcca cgaagacctg ctcgtgcgta ctgatgccgc ctcggtggaa       240
     gcctgcttga agatctgcct gccgcagctg cgtgcccgcg gtctggtcat ccctgagtaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page