(data stored in ACNUC7421 zone)

EMBL: BA000030.PE628

BA000030.PE628       Location/Qualifiers
FT   CDS_pept        775498..775956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_622"
FT                   /old_locus_tag="SAV_622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_622"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68332"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q98"
FT                   /protein_id="BAC68332.1"
FT                   /translation="MAEHIAGLCTTRHTPYAPRALLRRPLGCPKPEKDLGGRPMTENEN
FT                   ERATELGDAIEAVRQGLLKAAAQGSDDLRFLVKETELEFIVELRKTGSTGAGVKAWVLS
FT                   GDGRLERSAGQTNRLTVRLGILAPESHPIDETHFGDKKDKGHPGPRQM"
     atggccgaac acatcgcggg actctgcacc acccgccaca ccccttacgc ccctcgcgct        60
     ctcttgcgcc gcccactcgg ctgcccaaag cctgaaaagg atctgggagg gaggcccatg       120
     accgagaacg agaacgaacg tgccaccgaa ctcggcgacg ccatcgaggc agtacgccag       180
     gggttgctga aggcagccgc acaaggcagc gacgacctac gcttcctggt caaggaaaca       240
     gagctcgaat tcatcgtcga actgcggaag acggggtcga ccggcgcggg tgtgaaggcc       300
     tgggtcctct ccggtgacgg acgcctcgag cggtctgccg gccaaaccaa ccggctcacc       360
     gtccggctgg ggatcctggc cccggaatca cacccgatcg acgagaccca cttcggcgac       420
     aagaaggaca agggccaccc gggaccgcgg cagatgtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page