(data stored in ACNUC7421 zone)

EMBL: BA000030.PE63

BA000030.PE63        Location/Qualifiers
FT   CDS_pept        72680..72901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_63"
FT                   /old_locus_tag="SAV_63"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_63"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67772"
FT                   /db_xref="GOA:Q82RT0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RT0"
FT                   /protein_id="BAC67772.1"
FT                   /translation="MPIAVDIDVMLARRKMSVGELADRVGITPANLAVLKNGRAKAVRF
FT                   ATLAALCEVLKCQPGDLLRWEAEDAAGG"
     atgccgatcg ccgtcgacat cgacgtgatg ctggccaggc ggaaaatgtc cgtaggcgag        60
     ctcgcggacc gcgtagggat cacgcccgcc aacctggcgg tactcaagaa cggccgcgcc       120
     aaggcggtgc gcttcgcgac gctcgccgcg ctctgcgagg tgctcaagtg ccagccgggc       180
     gacctgctgc gctgggaggc cgaggacgcc gcaggcggat ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page