(data stored in ACNUC7421 zone)
EMBL: BA000030.PE63
BA000030.PE63 Location/Qualifiers
FT CDS_pept 72680..72901
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="SAVERM_63"
FT /old_locus_tag="SAV_63"
FT /product="putative transcriptional regulatory protein"
FT /db_xref="EnsemblGenomes-Gn:SAVERM_63"
FT /db_xref="EnsemblGenomes-Tr:BAC67772"
FT /db_xref="GOA:Q82RT0"
FT /db_xref="InterPro:IPR001387"
FT /db_xref="InterPro:IPR010982"
FT /db_xref="UniProtKB/TrEMBL:Q82RT0"
FT /protein_id="BAC67772.1"
FT /translation="MPIAVDIDVMLARRKMSVGELADRVGITPANLAVLKNGRAKAVRF
FT ATLAALCEVLKCQPGDLLRWEAEDAAGG"
atgccgatcg ccgtcgacat cgacgtgatg ctggccaggc ggaaaatgtc cgtaggcgag 60
ctcgcggacc gcgtagggat cacgcccgcc aacctggcgg tactcaagaa cggccgcgcc 120
aaggcggtgc gcttcgcgac gctcgccgcg ctctgcgagg tgctcaagtg ccagccgggc 180
gacctgctgc gctgggaggc cgaggacgcc gcaggcggat ga 222
//
If you have problems or comments...
Back to PBIL home page