(data stored in ACNUC7421 zone)

EMBL: BA000030.PE630

BA000030.PE630       Location/Qualifiers
FT   CDS_pept        complement(776473..777039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_624"
FT                   /old_locus_tag="SAV_624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_624"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68334"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q96"
FT                   /protein_id="BAC68334.1"
FT                   /translation="MPASPAASAQAIALLRELGATEIAHPGGTLLAHLQRVQEQLAVWE
FT                   ARTALQLAGLCHAFYGTDGFPAALLSLDRRDELAAAIGVEAEGIVYLYASCDRKATYPT
FT                   LADADASFRDRFTGRARIPEPQLRRDFAELSAANELDLARIDPAFREKWGSELLALCTR
FT                   FRPLLSQPAWSACHVVLAPDPPAQD"
     gtgcctgctt cccctgccgc ttccgctcag gccatcgcgc tcctgcgcga actcggcgcc        60
     acagagatcg cccatccggg cggcactctc ctcgcgcacc tccagcgcgt ccaagagcaa       120
     ctcgccgtat gggaggcacg caccgccctc cagcttgcgg gcctgtgcca tgcgttctac       180
     ggcaccgacg gcttccccgc cgcattgctg tccctggacc gccgcgacga actcgcagcg       240
     gcgatcggcg tcgaggccga aggcatcgtg tacctctacg cctcgtgcga ccggaaggcc       300
     acctatccga cgctcgcgga tgccgacgcc tccttccgcg accggttcac cggccgtgcc       360
     cgtattccgg agccgcagct gcgccgggac ttcgctgagc tgtctgccgc caacgaactc       420
     gacctcgccc gcatcgatcc ggccttccgt gagaagtggg gatccgaact cctcgccctg       480
     tgcactcgat tccgccccct gctgagccaa ccagcctggt cggcctgcca cgtggtgctt       540
     gctccggatc cccctgcgca ggactga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page