(data stored in ACNUC7421 zone)

EMBL: BA000030.PE632

BA000030.PE632       Location/Qualifiers
FT   CDS_pept        778334..779140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_626"
FT                   /old_locus_tag="SAV_626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_626"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68336"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q94"
FT                   /protein_id="BAC68336.1"
FT                   /translation="MSVAGMPGLALRPMDDKDLPPRLTHLTFHGPLSEARAARIIGRLA
FT                   RAAPSTVLDIGCGWGELMLRTLETVEGATGLGIDLNGQDIARGRENAKARALADRVKFV
FT                   EESAAGTARGPADLVLCLGASHTLSDAQPPQHTTAALHALRRLVQPGGRVLLGENFWQR
FT                   TPTSAELDAMWPGARAEEFHDLAGLVDLAVASGFRPAWIETASSDEWDEFESGYQSDVE
FT                   EWLAAHSDHPLAAETRERVDRHRASWLKGYRGVLGLAYLTLVPVDH"
     atgtcggtgg cgggcatgcc ggggctagcg ttgcgcccca tggatgacaa ggatcttccg        60
     ccgcgcctta cccatctcac ctttcacggt cccctttccg aagcccgagc cgcacggatc       120
     atcggcagac ttgcccgagc ggcaccctcg actgtcctcg acatcggttg tggctggggg       180
     gagctgatgc tccgcaccct cgagacggtg gagggggcga ccggtctcgg tatcgacctc       240
     aatggccagg acatcgcccg gggacgcgag aacgccaagg cccgtgcact ggctgaccgc       300
     gtgaagttcg tcgaagaatc tgcagccgga acggcacgtg ggcctgctga cctcgtcctg       360
     tgcttgggag ccagccacac gctcagcgac gcacagccac ctcagcacac caccgccgca       420
     ctgcacgcgc tgcgacggct ggtccagccc gggggacgcg tcctcctcgg tgagaatttc       480
     tggcagcgca cccccacctc ggccgaactc gacgcgatgt ggccgggcgc ccgcgccgaa       540
     gagttccacg acctggccgg actcgtcgac ctcgctgtcg cctccgggtt ccgccctgcc       600
     tggatcgaga cggcgagcag cgacgaatgg gacgagttcg agtccggcta ccagtccgac       660
     gtggaggagt ggctggccgc ccacagcgac cacccgctgg ctgctgagac gcgggagcgc       720
     gtggaccggc accgggcgag ctggctgaaa ggctaccgag gagtactcgg gctggcctat       780
     ctcacgttgg tccccgttga ccactga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page