(data stored in ACNUC7421 zone)

EMBL: BA000030.PE635

BA000030.PE635       Location/Qualifiers
FT   CDS_pept        782844..783239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_629"
FT                   /old_locus_tag="SAV_629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_629"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68339"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q91"
FT                   /protein_id="BAC68339.1"
FT                   /translation="MTTLPTTSAAAAERLGPARALTRAVAAYSALWRPFGTNDGSGLVR
FT                   EQVPVAADDKPYSYEWPYSQVHIAALDLTAVDAAYESEPAERTKAQEHFWHVGKGTTGC
FT                   PGYASYPVVACGEGGEGGAAPRRRPAP"
     ttgacgacct tgccgaccac atcggcagcc gcggcggagc gcttgggccc ggcccgggcg        60
     ttgacgcgcg ccgtcgccgc gtactccgcg ctctggagac ccttcggaac gaacgacggt       120
     tccgggctgg tccgcgagca ggttccggtg gccgccgacg acaagccgta ctcgtacgaa       180
     tggccctact cgcaggtgca catcgccgcg ctcgacctca cggccgtgga cgcggcgtac       240
     gagtcggagc cagccgaacg gacaaaggcg caggagcact tctggcacgt cggcaaaggc       300
     acgaccgggt gtcccggata cgcctcctac cctgtcgtcg cgtgcggcga gggcggcgag       360
     ggcggcgcag cgccacggcg gcgaccagcc ccatga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page